PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g003170.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CPP
Protein Properties Length: 621aa    MW: 67230.8 Da    PI: 7.9288
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g003170.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.51.5e-14141180242
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                       ++k+CnCk+s+Clk+YCeCfa+g++C+  C+C++C+N+ e+
  Sopen12g003170.2 141 KQKQCNCKHSRCLKLYCECFASGVYCDG-CNCNNCHNNVEN 180
                       89**************************.********9875 PP

2TCR50.83.3e-16225264140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Sopen12g003170.2 225 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 264
                       589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.1E-16140180IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.088141265IPR005172CRC domain
PfamPF036382.1E-11142177IPR005172CRC domain
SMARTSM011148.4E-20225266IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12228263IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MEKSEGGDSF PPNKGQSEVV VSSTVGTGVD FPAKKLARQL DFTVFGQSPA AAVTAVTEQS  60
QKIQPLVMTT SGTQIVPVKL TTVQRPQLQP PPQPQQHMVL MPMKQTAVPP AHPSIRPPKP  120
ESPRARPRQS ASEVKDGTPK KQKQCNCKHS RCLKLYCECF ASGVYCDGCN CNNCHNNVEN  180
EPARREAVEA TLERNPHAFR PKIASSPHGA RDNKEEAGDG LVLAKHNKGC HCKKSGCLKK  240
YCECFQANIL CSENCKCMDC KNFEGSEERQ ALFHGDHANN MAYLQQAANA AITGAIGSSG  300
YGSPPVNKKR KSPELFFGST IKDPVHRHGQ LQQGNHIKSS VLPSLSSSPG PCVGNAATVG  360
PSKFTYRSLL EDLIQPQDLK ELCSVLVVYS GEAAKMLADE KDASKKQGEG QTQASLASST  420
QEQVQNQKDS GSEKDMLDCS SSGDQGEKIS MKESSLDGAD VSKRRPMSPG TLALMCDESD  480
TMFAAAITSP DDLATLGCNT SSQLPHGQGM TETYAEQERI VLTKFRDCLN RLVTLGEIKE  540
KKCSSMVRGI DFVDQRDMIG NGFTTTETRI QHDSFNKGVS NSPVPQPRTT QMFSSVATTA  600
NNNALPKVHR PDENGDVKPT I
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015061276.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0V0IHB40.0A0A0V0IHB4_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000008240.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24012455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein